PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT4G24020.1
Common NameNLP7, T19F6.16
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family Nin-like
Protein Properties Length: 959aa    MW: 105742 Da    PI: 5.6877
Description NIN like protein 7
Gene Model
Gene Model ID Type Source Coding Sequence
AT4G24020.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK91.94.9e-29589639252
       RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                  ek+isl++l++yF +++kdAAk+Lgvc+T++KriCRq+GI+RWP+Rkik++
  AT4G24020.1 589 EKTISLDVLQQYFTGSLKDAAKSLGVCPTTMKRICRQHGISRWPSRKIKKV 639
                  799**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF557814.81E-5214283IPR029016GAF domain-like
PROSITE profilePS5151917.757578659IPR003035RWP-RK domain
PfamPF020427.3E-26591639IPR003035RWP-RK domain
SuperFamilySSF542775.23E-23860948No hitNo description
SMARTSM006668.9E-28863945IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2401.3E-26863945No hitNo description
PROSITE profilePS5174527.429863945IPR000270PB1 domain
PfamPF005648.5E-20863944IPR000270PB1 domain
CDDcd064076.30E-34864944No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009414Biological Processresponse to water deprivation
GO:0010118Biological Processstomatal movement
GO:0010167Biological Processresponse to nitrate
GO:0042128Biological Processnitrate assimilation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0005515Molecular Functionprotein binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000039anatomyshoot axis vascular system
PO:0000046anatomyseminal root
PO:0000074anatomyparenchyma cell
PO:0000230anatomyinflorescence meristem
PO:0000256anatomyroot hair cell
PO:0000293anatomyguard cell
PO:0002000anatomystomatal complex
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 959 aa     Download sequence    Send to blast
MCEPDDNSAR NGVTTQPSRS RELLMDVDDL DLDGSWPLDQ IPYLSSSNRM ISPIFVSSSS  60
EQPCSPLWAF SDGGGNGFHH ATSGGDDEKI SSVSGVPSFR LAEYPLFLPY SSPSAAENTT  120
EKHNSFQFPS PLMSLVPPEN TDNYCVIKER MTQALRYFKE STEQHVLAQV WAPVRKNGRD  180
LLTTLGQPFV LNPNGNGLNQ YRMISLTYMF SVDSESDVEL GLPGRVFRQK LPEWTPNVQY  240
YSSKEFSRLD HALHYNVRGT LALPVFNPSG QSCIGVVELI MTSEKIHYAP EVDKVCKALE  300
AVNLKSSEIL DHQTTQICNE SRQNALAEIL EVLTVVCETH NLPLAQTWVP CQHGSVLANG  360
GGLKKNCTSF DGSCMGQICM STTDMACYVV DAHVWGFRDA CLEHHLQKGQ GVAGRAFLNG  420
GSCFCRDITK FCKTQYPLVH YALMFKLTTC FAISLQSSYT GDDSYILEFF LPSSITDDQE  480
QDLLLGSILV TMKEHFQSLR VASGVDFGED DDKLSFEIIQ ALPDKKVHSK IESIRVPFSG  540
FKSNATETML IPQPVVQSSD PVNEKINVAT VNGVVKEKKK TEKKRGKTEK TISLDVLQQY  600
FTGSLKDAAK SLGVCPTTMK RICRQHGISR WPSRKIKKVN RSITKLKRVI ESVQGTDGGL  660
DLTSMAVSSI PWTHGQTSAQ PLNSPNGSKP PELPNTNNSP NHWSSDHSPN EPNGSPELPP  720
SNGHKRSRTV DESAGTPTSH GSCDGNQLDE PKVPNQDPLF TVGGSPGLLF PPYSRDHDVS  780
AASFAMPNRL LGSIDHFRGM LIEDAGSSKD LRNLCPTAAF DDKFQDTNWM NNDNNSNNNL  840
YAPPKEEAIA NVACEPSGSE MRTVTIKASY KDDIIRFRIS SGSGIMELKD EVAKRLKVDA  900
GTFDIKYLDD DNEWVLIACD ADLQECLEIP RSSRTKIVRL LVHDVTTNLG SSCESTGEL
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1865129800.0
Genevisible254195_at0.0
Expression AtlasAT4G24020-
AtGenExpressAT4G24020-
ATTED-IIAT4G24020-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in roots, stems, leaves, flowers and siliques. Detected in root hairs, emerging secondary roots, vascular tissues, leaf parenchyma cells and stomata. {ECO:0000269|PubMed:18826430}.
Functional Description ? help Back to Top
Source Description
TAIREncodes NIN Like Protein 7 (NLP7). Modulates nitrate sensing and metabolism. Mutants of NLP7 show features of nitrogen-starved plants and are tolerant to drought stress. Localized in the nucleus and functions as a putative transcription factor.
UniProtTranscription factor involved in regulation of nitrate assimilation and in transduction of the nitrate signal. {ECO:0000269|PubMed:18826430}.
Function -- GeneRIF ? help Back to Top
  1. NLP7 is an important element of the nitrate signal transduction pathway and is proposed as a new regulatory protein specific for nitrogen assimilation in non-nodulating plants.
    [PMID: 18826430]
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00449DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT4G24020.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Not regulated by the N source or by nitrate. {ECO:0000269|PubMed:18826430}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Regulation -- ATRM (Manually Curated Target Genes) ? help Back to Top
Source Target Gene (A: Activate/R: Repress)
ATRM AT1G08100(A)
Phenotype -- Disruption Phenotype ? help Back to Top
Source Description
UniProtDISRUPTION PHENOTYPE: N-starvation phenotype. Smaller rosette, but no effects on roots. Delayed growth and flowering when grown in greenhouse. Increased drought resistance. {ECO:0000269|PubMed:18826430}.
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT4G24020
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2284520.0AK228452.1 Arabidopsis thaliana mRNA for hypothetical protein, complete cds, clone: RAFL15-03-P13.
GenBankBT0057760.0BT005776.1 Arabidopsis thaliana clone RAFL15-03-P13 (R20174) unknown protein (At4g24020) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_194133.10.0NIN like protein 7
SwissprotQ84TH90.0NLP7_ARATH; Protein NLP7
TrEMBLD7M8Y60.0D7M8Y6_ARALL; RWP-RK domain-containing protein
STRINGAT4G24020.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM25072666
Representative plantOGRP2991697
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Menges M,Hennig L,Gruissem W,Murray JA
    Cell cycle-regulated gene expression in Arabidopsis.
    J. Biol. Chem., 2002. 277(44): p. 41987-2002
    [PMID:12169696]
  3. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  4. Scheible WR, et al.
    Genome-wide reprogramming of primary and secondary metabolism, protein synthesis, cellular growth processes, and the regulatory infrastructure of Arabidopsis in response to nitrogen.
    Plant Physiol., 2004. 136(1): p. 2483-99
    [PMID:15375205]
  5. Schauser L,Wieloch W,Stougaard J
    Evolution of NIN-like proteins in Arabidopsis, rice, and Lotus japonicus.
    J. Mol. Evol., 2005. 60(2): p. 229-37
    [PMID:15785851]
  6. Castaings L, et al.
    The nodule inception-like protein 7 modulates nitrate sensing and metabolism in Arabidopsis.
    Plant J., 2009. 57(3): p. 426-35
    [PMID:18826430]
  7. Wang R,Xing X,Wang Y,Tran A,Crawford NM
    A genetic screen for nitrate regulatory mutants captures the nitrate transporter gene NRT1.1.
    Plant Physiol., 2009. 151(1): p. 472-8
    [PMID:19633234]
  8. Hachiya T, et al.
    Evidence for a nitrate-independent function of the nitrate sensor NRT1.1 in Arabidopsis thaliana.
    J. Plant Res., 2011. 124(3): p. 425-30
    [PMID:21052766]
  9. Konishi M,Yanagisawa S
    Arabidopsis NIN-like transcription factors have a central role in nitrate signalling.
    Nat Commun, 2013. 4: p. 1617
    [PMID:23511481]
  10. Jin J, et al.
    An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors.
    Mol. Biol. Evol., 2015. 32(7): p. 1767-73
    [PMID:25750178]